Yucca GLP-1Sema & Tirz from YuccaSemaglutide & Tirzepatide from Yucca·Wegovy$1,349$125/mo91% lessUS-licensed Rx2–4 day shipNo feesBuy now, pay later
Take the 1-min quizTake quiz
PDPeptideDeck
01· StoreShop Peptides↗02GLP-1 Suppliers03Calculator04Free TrialAI Coach
Shop
Start HerePeptide Vendors →
Home/Peptides/PeptidesLL-37 Dosage Guide: Reconstitution, Protocols & Cycle Length (2026)
Peptides13

LL-37 Dosage Guide: Reconstitution, Protocols & Cycle Length (2026)

Published June 16, 2026Updated July 17, 2026
Quick Brief

LL 37 dosage: reconstitution math with bac water, reported research dose ranges, route, frequency and cycle length, plus a dosing table.

Procurement

In StockShips from USA

Research Peptides

Research peptides from Synthro Lab, made in the USA with 99% tested purity and endotoxin testing. LL-37 is a niche research-only peptide; browse the catalog for related compounds. Buy 1 Get 1 Free.

Shop Research Peptides at Synthro Lab
Contents0%
What Is LL-37 (Just Enough for Dosing)What the Human Dosing Evidence Actually IsTopical wound dosing (the strongest human data)Intratumoral dosingHow to Reconstitute LL-37The five stepsThe math in one lineReported Research Dosing: Route, Frequency, and Cycle LengthFrequency and route in practiceCycle lengthStorage and StabilitySide Effects and SafetyHow LL-37 sits next to related peptidesFrequently Asked QuestionsBottom LineReferences

Procurement

Research Peptides

In StockShips from USA
Shop Research Peptides at Synthro Lab

LL-37 is the only cathelicidin antimicrobial peptide made in the human body, a 37-residue, cationic, amphipathic helix released from the precursor protein hCAP18.[1][3] Most LL-37 questions online are really dosing questions: how to reconstitute the lyophilized powder with bacteriostatic water, what route and frequency the research uses, and how long a cycle should run. This guide answers those questions specifically. It walks through the reconstitution math step by step, separates the dosing routes that have actually been tested in humans (topical and intratumoral) from the injectable "research dosing" that circulates in forums, and gives you a clean reconstitution and dosing reference table. For the broader story of what LL-37 is and what it does, see our overview of antimicrobial peptides LL-37 and KPV; this page is the dosing companion to it. Everything here is framed for research context only.

Last UpdatedJune 16, 2026
37Amino acids
~4.5 kDaMolecular weight
Topical / ITOnly human-tested routes
Research onlyUS regulatory status

🔑 Key Takeaways

  • LL-37 is the single human cathelicidin, a 37-amino-acid peptide of about 4.5 kDa that is cationic (net charge near +6) and folds into an amphipathic alpha-helix once released from hCAP18 by proteolytic cleavage.[1][3]
  • The only LL-37 doses ever tested in human trials were topical, applied to wounds at 0.5 to 1.6 mg/mL twice weekly, and intratumoral injections placed directly into melanoma nodules. There is no validated subcutaneous LL-37 protocol.[3][4][5]
  • In a Phase I/IIa venous leg ulcer trial, the lower topical concentrations (0.5 and 1.6 mg/mL) sped healing, while the highest (3.2 mg/mL) showed no advantage, a reminder that for LL-37 more is not better.[4]
  • Reconstitution is simple division: dose volume equals the dose you want divided by the concentration (mg per mL) you created with bacteriostatic water, then converted to insulin-syringe units.[1]
  • LL-37 acts as both antimicrobial and immune modulator, and its effects flip between anti-inflammatory and pro-inflammatory depending on concentration and context, which is one reason injectable dosing is hard to standardize.[2]
  • LL-37 is not FDA-approved for any use and is sold for laboratory research only.[3]

What Is LL-37 (Just Enough for Dosing)

LL-37 is the C-terminal active fragment of human cationic antimicrobial protein 18 (hCAP18), the only cathelicidin gene product in people. The 18 kDa precursor is cleaved by proteases to release the mature 37-residue peptide, named for its first two leucine residues.[1][2] Its full sequence is [LL-37, 37 aa], and that string of lysines and arginines is what makes it strongly cationic with a net charge around +6, folding into an amphipathic alpha-helix with no disulfide bonds.[1][3]

Why does this matter for dosing? Because LL-37 is a relatively large, charged peptide (about 4.5 kDa), it is fragile in solution, so handling and concentration matter. And because it is multifunctional rather than single-target, the same milligram can behave very differently at different concentrations. We keep the biology brief here on purpose; if you want the mechanism and benefits in depth, read our companion piece on antimicrobial peptides LL-37 and KPV and the basics in what are peptides.

What the Human Dosing Evidence Actually Is

This is the most important section, because the honest answer surprises most people: the only LL-37 doses ever studied in humans were delivered topically to wounds or injected directly into tumors, not as a daily subcutaneous shot.

Topical wound dosing (the strongest human data)

A first-in-human Phase I/IIa trial in hard-to-heal venous leg ulcers enrolled 34 patients and applied LL-37 topically to the wound bed at 0.5, 1.6, or 3.2 mg/mL twice weekly for four weeks. The two lower concentrations clearly accelerated healing (mean ulcer area fell about 68 percent at 0.5 mg/mL and 50 percent at 1.6 mg/mL), while the highest 3.2 mg/mL concentration was no better than placebo.[4] A larger Phase IIb study (HEAL LL-37) then treated 148 patients with the 0.5 or 1.6 mg/mL topical doses twice weekly; the drug was well tolerated and safe at both strengths, though the overall efficacy result was mixed and a benefit was strongest in patients with large ulcers.[5]

Intratumoral dosing

The other human route is direct tumor injection. A completed Phase 1 trial injected LL-37 into cutaneous melanoma metastases on a weekly schedule to test its anticancer potential.[3] This is a clinician-administered, image-guided research setting, not anything an individual can replicate at home.

The gap nobody mentions

The "LL-37 dosage" most people are searching for, a reconstituted subcutaneous injection of a few hundred micrograms per day, has never been validated in a human clinical trial. Those numbers come from vendor sheets and community protocols, not from the published research, which used topical and intratumoral routes. Treat any injectable LL-37 dose as an unvalidated experiment, not an established protocol.[3][4][5]

How to Reconstitute LL-37

LL-37 ships as a lyophilized (freeze-dried) white powder that has to be dissolved before it can be measured or used. The diluent of choice is bacteriostatic water, which contains 0.9 percent benzyl alcohol to limit microbial growth across a multi-day vial. Our full bacteriostatic water guide and the step-by-step how to reconstitute peptides walkthrough cover the technique in detail; the short version follows.

The five steps

1. Let both vials reach room temperature, then wipe both stoppers with alcohol. 2. Decide how much bacteriostatic water to add (this sets your concentration, see the table). 3. Draw the water with a syringe and inject it slowly down the inside wall of the peptide vial, never blasting it directly onto the powder. 4. Do not shake. Swirl gently or let it sit until the LL-37 fully dissolves into a clear solution. 5. Label the vial with the date and concentration, and refrigerate.

The math in one line

Concentration equals total peptide mass divided by the volume of water you add. So 5 mg of LL-37 reconstituted with 2 mL of bacteriostatic water gives 2.5 mg/mL, which is the same as 2,500 mcg per mL. To find the volume for a given research dose, divide the dose by that concentration. On a U-100 insulin syringe, 1 mL equals 100 units, so 0.1 mL equals 10 units. If you would rather not do the arithmetic by hand, our peptide unit conversion calculator converts mg, mcg, mL, and U-100 units for you.

Vial size
Bac water added
Final concentration
Volume for a 250 mcg amount
U-100 units
5 mg
1 mL
5,000 mcg/mL
0.05 mL
5 units
5 mg
2 mL
2,500 mcg/mL
0.10 mL
10 units
5 mg
5 mL
1,000 mcg/mL
0.25 mL
25 units
10 mg
2 mL
5,000 mcg/mL
0.05 mL
5 units
5 mg
Bac water added
1 mL
Final concentration
5,000 mcg/mL
Volume for a 250 mcg amount
0.05 mL
U-100 units
5 units
5 mg
Bac water added
2 mL
Final concentration
2,500 mcg/mL
Volume for a 250 mcg amount
0.10 mL
U-100 units
10 units
5 mg
Bac water added
5 mL
Final concentration
1,000 mcg/mL
Volume for a 250 mcg amount
0.25 mL
U-100 units
25 units
10 mg
Bac water added
2 mL
Final concentration
5,000 mcg/mL
Volume for a 250 mcg amount
0.05 mL
U-100 units
5 units

Two practical notes. More dilute solutions (more water per milligram) make small research amounts easier to measure, because each syringe unit carries less peptide. And the 250 mcg figure in the table is only a worked example to show the arithmetic, not a recommended dose; swap in whatever amount your research protocol specifies and the division works the same way.

Reported Research Dosing: Route, Frequency, and Cycle Length

Because there is no approved human injectable protocol, the table below separates what the published trials actually used from the anecdotal injectable ranges that circulate online. The clinical rows are evidence-based; the anecdotal row is explicitly not.

Context
Route
Amount used / reported
Frequency
Course
Venous leg ulcer trials (clinical)
Topical to wound bed
0.5 to 1.6 mg/mL formulation[4][5]
Twice weekly
About 4 weeks
Melanoma trial (clinical)
Intratumoral injection
Microgram-level per nodule[3]
Weekly
Up to several weeks
Anecdotal injectable (not validated)
Subcutaneous (reconstituted)
Community-reported low microgram amounts
Often once daily
Short blocks, then a break
Venous leg ulcer trials (clinical)
Route
Topical to wound bed
Amount used / reported
0.5 to 1.6 mg/mL formulation[4][5]
Frequency
Twice weekly
Course
About 4 weeks
Melanoma trial (clinical)
Route
Intratumoral injection
Amount used / reported
Microgram-level per nodule[3]
Frequency
Weekly
Course
Up to several weeks
Anecdotal injectable (not validated)
Route
Subcutaneous (reconstituted)
Amount used / reported
Community-reported low microgram amounts
Frequency
Often once daily
Course
Short blocks, then a break

Frequency and route in practice

The trial route that worked was topical, applied just twice weekly, which tells you that LL-37 does not need constant exposure to influence a wound. The injectable subcutaneous route many forum protocols describe has no trial behind it, so frequency claims (daily, every other day, and so on) are guesses. If you are weighing injection routes generally, our comparison of subcutaneous versus intramuscular injection for peptides and the practical how to inject peptides guide cover technique, though neither makes LL-37 itself a proven injectable.

Cycle length

There is no established LL-37 cycle. The clinical topical courses ran about four weeks; community injectable "cycles" usually mimic other research peptides with two to four week blocks followed by time off, but that pattern is borrowed, not validated for LL-37. A defensible conservative stance is to treat any self-directed use as short and experimental rather than open-ended, since the dose-response data we do have showed that pushing the concentration higher backfired.[4]

Why higher is not better with LL-37

LL-37 is a double-edged immune modulator. It can suppress pro-inflammatory cytokines and neutralize bacterial endotoxin at some concentrations, yet promote inflammation, mast cell activation, and cell stress at others.[2] That concentration-dependent flip is the likely reason the highest 3.2 mg/mL topical dose lost its benefit in the wound trial, and it is exactly why escalating an unvalidated injectable dose is risky.[2][4]

Top Pick Research Peptides Research peptides from Synthro Lab, made in the USA with 99% tested purity and endotoxin testing. LL-37 is a niche research-only peptide; browse the catalog for related compounds. Buy 1 Get 1 Free.
Shop Research Peptides at Synthro Lab

Storage and Stability

Keep the dry, unreconstituted vial frozen or refrigerated and out of light. Once reconstituted, refrigerate at roughly 2 to 8 degrees Celsius and use within a few weeks, discarding sooner if the solution turns cloudy or shows particulates. Avoid freeze-thaw cycles and never shake it, since agitation and temperature swings degrade fragile peptides. Our guide on how to store peptides so they actually last goes deeper on shelf life and cold-chain handling.

Side Effects and Safety

In the controlled topical wound trials, LL-37 was well tolerated and safe at the 0.5 and 1.6 mg/mL strengths, with adverse events that were mostly mild to moderate and no treatment-related deaths.[5] That reassurance applies to a defined topical formulation under medical supervision, not to homemade subcutaneous injections. Because LL-37 modulates immune signaling in a context-dependent way and can trigger mast cell degranulation and inflammatory responses at the wrong concentration, an unstandardized injectable dose carries unknowns the trials never measured.[2] For a structured look at how injectable peptides can go wrong, see our peptide side effects guide, and for the legal picture read are peptides legal. LL-37 is not FDA-approved and is sold for research use only.[3]

How LL-37 sits next to related peptides

People researching LL-37 for gut or immune reasons often compare it with other compounds. The shorter tripeptide KPV is the usual partner for gut and anti-inflammatory research, BPC-157 is the go-to tissue-repair option, and on the immune side the more clinically developed thymosin alpha-1 offers useful context. None of these change LL-37's own dosing, but they explain why people reconstitute it in the first place.

PureBac 7x tested bacteriostatic water 10mL vial
7x Quality Tested Bac Water

Don't ruin a $300 peptide on generic bac water.

Sterile, non-pyrogenic, exactly 0.9% benzyl alcohol, with a COA on every batch. Made for peptide reconstitution, not repackaged from generic stock.

0.9% benzyl alcohol 7x tested in USA COA every batch
Get PureBac bac water From $7.99 · Free shipping over $150

Frequently Asked Questions

What is the typical LL-37 dosage?
There is no approved human dose. The only doses ever tested in trials were topical (0.5 to 1.6 mg/mL applied to wounds twice weekly) and intratumoral injections into melanoma nodules.[3][4][5] The injectable subcutaneous amounts quoted online are community estimates, not trial-validated protocols, so there is no reliable "standard" injectable dose.
How do I reconstitute LL-37 with bacteriostatic water?
Add bacteriostatic water slowly down the vial wall and let it dissolve without shaking. The concentration is just the peptide mass divided by the water volume: 5 mg in 2 mL equals 2.5 mg/mL, or 2,500 mcg per mL.[1] See the reconstitution table above and our reconstitution guide for the full method.
How many units of LL-37 should I draw on an insulin syringe?
That depends entirely on your concentration. On a U-100 syringe, 1 mL is 100 units, so if you reconstitute 5 mg in 2 mL (2,500 mcg/mL), then 10 units equals 0.1 mL equals 250 mcg. Change the water volume and the units per amount change too. Our unit conversion calculator handles the math.
How long is an LL-37 cycle?
No cycle length is validated for injectable LL-37. The clinical topical courses ran about four weeks of twice-weekly application.[4][5] Community injectable protocols borrow a two to four week block from other peptides, but that is not specific to LL-37, and the dose-response data suggest restraint rather than longer or higher dosing.[4]
Is LL-37 injected subcutaneously or applied topically?
In the published human research it was topical (on wounds) or intratumoral (into tumors), not subcutaneous.[3][4][5] The subcutaneous injection many people ask about is an off-label, unvalidated practice. If you do compare routes generally, see subcutaneous versus intramuscular injection.
Does more LL-37 work better?
No. In the wound trial the highest concentration (3.2 mg/mL) lost the benefit seen at lower doses, and LL-37 is known to switch between anti-inflammatory and pro-inflammatory effects depending on concentration.[2][4] With this peptide, restraint appears to matter more than escalation.
Is LL-37 legal or FDA-approved?
LL-37 is not approved by the FDA for any indication and is sold strictly for laboratory research use, not human consumption.[3] For the wider regulatory picture, see our guide on whether peptides are legal.

Bottom Line

LL-37 dosing is mostly an exercise in honesty. The real human evidence is a topical wound formulation applied at 0.5 to 1.6 mg/mL twice weekly and an intratumoral melanoma injection, both clinician-administered, with the clear lesson that the highest concentration was not the best.[3][4][5] The reconstitution math itself is straightforward: dissolve the lyophilized vial in bacteriostatic water, and dose volume equals desired amount divided by concentration, then converted to insulin-syringe units.[1] What does not exist is a validated subcutaneous LL-37 protocol, so the daily injectable "dosage" people search for is an extrapolation, not a standard, and one made riskier by LL-37's concentration-dependent flip between calming and stoking inflammation.[2] If you are going to handle it, keep the chemistry careful, treat any self-directed use as short and experimental, and involve a qualified clinician before considering any peptide.

References

  1. LL-37: Structures, Antimicrobial Activity, and Influence on Amyloid-Related Diseases. (peer-reviewed review) PMC10968335.
  2. Cathelicidin Host Defense Peptides and Inflammatory Signaling: Striking a Balance. Front Microbiol 2020;11:1902 (10.3389/fmicb.2020.01902).
  3. Renovation as innovation: Repurposing human antibacterial peptide LL-37 for cancer therapy. Front Pharmacol 2022;13:944147 (PMC9445486).
  4. Gronberg A, et al. Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trial. Wound Repair Regen. 2014 (PMID 25041740).
  5. Mahlapuu M, et al. Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: a multicentric prospective randomized placebo-controlled clinical trial. Wound Repair Regen. 2021 (PMC9298190).
Medical Disclaimer: This article is for educational and informational purposes only and is not medical advice. LL-37 is not approved by the FDA for the prevention, treatment, or cure of any disease, and products are sold for laboratory research use only. The reconstitution math, routes, and dosing figures described here come from published clinical trials, vendor references, or worked examples and are not recommendations or instructions to self-administer. The injectable subcutaneous use commonly discussed online has not been validated in human trials. Nothing here should be used to diagnose, treat, or self-administer any compound. Always consult a qualified, licensed healthcare professional before considering any peptide, especially if you are pregnant, breastfeeding, immunosuppressed, or taking other medications.

Recommended Supplier

In StockShips from USA

Research Peptides

Research peptides from Synthro Lab, made in the USA with 99% tested purity and endotoxin testing. LL-37 is a niche research-only peptide; browse the catalog for related compounds. Buy 1 Get 1 Free.

Shop Research Peptides at Synthro Lab

Related Topics

LL-37ll 37 dosagepeptide reconstitutionbacteriostatic watercathelicidinantimicrobial peptidesresearch peptidesdosage guide
Back to Peptides
Contents0%
What Is LL-37 (Just Enough for Dosing)What the Human Dosing Evidence Actually IsTopical wound dosing (the strongest human data)Intratumoral dosingHow to Reconstitute LL-37The five stepsThe math in one lineReported Research Dosing: Route, Frequency, and Cycle LengthFrequency and route in practiceCycle lengthStorage and StabilitySide Effects and SafetyHow LL-37 sits next to related peptidesFrequently Asked QuestionsBottom LineReferences
Shop Research Peptides at Synthro Lab
PDPeptideDeck

Research-backed guides, dosing tools and reviews for peptides and GLP-1 medications.

01 · Explore

  • Peptide Guides
  • Oral Peptides
  • HRT Guide
  • TRT Guide
  • Blog
  • Calculators
  • AI Coach
  • Shop

02 · GLP-1

  • GLP-1 Guide
  • GLP-1 Programs
  • GLP-1 Reviews

03 · Company

  • About
  • Contact

04 · Dosing Charts

MOTS-cSermorelinSelankGHK-CuSemaglutideGLOWTesamorelin5-Amino-1MQCagrilintideMK-677FOXO4-DRIZepboundMounjaroWegovyKisspeptinSS-31Thymosin Alpha-1KPVEnclomipheneGlutathione
© 2026 PeptideDeck