Prescription GLP-1

Weight management medications

GLP-1 Injections
Starting at $179GLP-1 InjectionsOne injection per week.
Wegovy® Pill
$99 + Med CostWegovy® PillOne pill per day.
GLP-1 Tablets
Starting at $249GLP-1 TabletsOne dissolvable tablet per day.
Wegovy® Injection
$99 + Med CostWegovy® Injection
Zepbound® Injection
$99 + Med CostZepbound® Injection
Get Started Today

Prescription required • Telehealth consultation included

GLP-1 Weight Lossfrom $99/mo
GLP-1 Injections
Wegovy® Pill
GLP-1 Tablets
+2 more
View All
sciencePeptideDeck
shopping_bagShop Peptidesopen_in_newOral PeptidesnewBlogPeptide CalculatorAI Coach
OralnewShop
menu_bookPeptide Guide
Homechevron_rightPeptideschevron_rightVosoritide
Bone Health & Growth
scheduleHalf-life: ~25-30 minutes (extended vs native CNP: 2-3 min)

Vosoritide

Vosoritide (Voxzogo) — C-Type Natriuretic Peptide Analog

shopping_cart
starRecommended

Purchase Vosoritide

Buy Nowarrow_forward
Vosoritide is a modified analog of C-type natriuretic peptide (CNP), a naturally occurring hormone that regulates skeletal development. Approved by the FDA in 2021 under the brand name Voxzogo, it represents the first pharmacological therapy specifically designed to address the underlying pathophysiology of achondroplasia—the most common form of disproportionate short stature. The peptide works by activating natriuretic peptide receptor B (NPR-B) in growth plate chondrocytes, counteracting the overactive FGFR3 signaling that suppresses bone elongation in achondroplasia. Clinical trials demonstrated statistically significant improvements in annualized growth velocity in children receiving daily subcutaneous injections. Unlike native CNP which has a half-life of only 2-3 minutes, vosoritide's modified structure extends its duration of action, making once-daily dosing feasible. This breakthrough positions vosoritide as a paradigm-shifting therapy that directly modulates the dysregulated signaling pathway rather than treating symptoms alone.
verifiedRecommended Supplier

Get Vosoritide

Sourced from Ascension Peptides. Verified ≥Pharmaceutical grade (Voxzogo) purity, third-party tested. COA included.

shopping_cartBuy Now
50%

Off with code

PEPTIDEDECK

Table of Contents

  • What is Vosoritide?
  • Research Benefits
  • How Vosoritide Works
  • Research Applications
  • Research Findings
  • Dosage & Administration
  • Safety & Side Effects
  • References

What is Vosoritide?

Vosoritide represents a landmark achievement in rare disease therapeutics—the first FDA-approved medication to directly address the underlying cause of achondroplasia, the most common form of disproportionate short stature (dwarfism). Marketed under the brand name Voxzogo by BioMarin Pharmaceutical, this peptide received FDA approval in November 2021 for children aged 5 and older with open growth plates.

39 Amino Acids
~25 min Half-life
2021 FDA Approved

The peptide is a modified analog of C-type natriuretic peptide (CNP), a naturally occurring hormone that plays a crucial role in skeletal development. Native CNP is produced in cartilage growth plates and acts as a positive regulator of bone elongation—essentially signaling the body to continue growing. However, native CNP has an extremely short half-life of only 2-3 minutes, making it impractical as a therapeutic agent.

Vosoritide's structure has been engineered to extend its half-life to approximately 25-30 minutes while preserving its biological activity. This modification enables once-daily subcutaneous dosing, transforming what was a basic science observation about CNP's growth-promoting effects into a clinically viable therapy.

ℹ️ Understanding Achondroplasia: Achondroplasia affects approximately 1 in 15,000-40,000 births worldwide. It's caused by mutations in the FGFR3 gene, which normally acts as a 'brake' on bone growth. When mutated, this brake becomes overactive, suppressing the cartilage-to-bone conversion necessary for limb elongation. Vosoritide works by counteracting this overactive signaling.

The development of vosoritide exemplifies the modern approach to rare disease drug development—starting with deep understanding of molecular pathophysiology, identifying natural regulators of the affected pathway, and engineering modified versions optimized for therapeutic use. For the achondroplasia community, which had no pharmacological treatment options for decades, vosoritide's approval marked a transformative moment.

Research Benefits

check_circle

Increased annualized growth velocity in children with achondroplasia

check_circle

Counteracts overactive FGFR3 signaling at the growth plate

check_circle

Promotes endochondral bone formation through NPR-B activation

check_circle

First FDA-approved disease-modifying therapy for achondroplasia

check_circle

Demonstrated sustained effect over multi-year treatment

check_circle

Improves upper-to-lower body segment ratio

check_circle

Generally well-tolerated safety profile in pediatric trials

check_circle

May reduce need for limb-lengthening surgeries

How Vosoritide Works

Understanding vosoritide's mechanism requires appreciating the delicate balance of signals that regulate bone growth at the growth plate—the specialized cartilage zone where long bones elongate during childhood and adolescence.

The Growth Plate and FGFR3 Signaling

In normal development, fibroblast growth factor receptor 3 (FGFR3) acts as a negative regulator of bone growth. When activated by its ligands (various FGF proteins), FGFR3 signals growth plate chondrocytes to slow their proliferation and differentiation. This 'brake' mechanism prevents excessive bone growth and helps regulate proportional development.

In achondroplasia, a single point mutation (most commonly glycine to arginine at position 380) causes FGFR3 to become constitutively overactive. The brake is permanently engaged too strongly, dramatically suppressing chondrocyte proliferation and endochondral ossification. The result is shortened limbs, particularly in the proximal segments (upper arms and thighs), with disproportionate effects on long bones relative to the spine and skull.

🦴

NPR-B Activation

Binds natriuretic peptide receptor B on growth plate chondrocytes, initiating pro-growth signaling.

🔄

Counteracts FGFR3

Opposes the excessive inhibitory signaling from overactive FGFR3 mutations.

📈

Promotes Elongation

Enhances chondrocyte proliferation and differentiation for improved bone growth.

C-Type Natriuretic Peptide: The Natural Counter-Signal

C-type natriuretic peptide (CNP) serves as a natural antagonist to FGFR3's growth-inhibiting effects. When CNP binds to natriuretic peptide receptor B (NPR-B) on chondrocytes, it activates production of cyclic GMP (cGMP). This intracellular messenger inhibits the MAPK/ERK pathway—the same pathway that FGFR3 activates to suppress growth. In essence, CNP and FGFR3 represent opposing arms of a signaling balance that regulates bone elongation.

Vosoritide amplifies this natural counter-regulatory mechanism. By providing pharmacological levels of NPR-B activation through daily dosing, the peptide helps overcome the excessive FGFR3 signaling present in achondroplasia. It doesn't fully normalize growth—children still have achondroplasia—but it meaningfully increases the rate of bone elongation.

Extended Half-Life Engineering

Native CNP (CNP-22 or CNP-53) is rapidly degraded by neutral endopeptidases and cleared from circulation within 2-3 minutes. Vosoritide's structure includes modifications that resist enzymatic degradation while maintaining receptor binding affinity. The extended half-life of approximately 25-30 minutes, combined with once-daily dosing, provides sustained NPR-B stimulation throughout the growth plate.

🔑 Key Takeaways

  • Achondroplasia results from overactive FGFR3 signaling that suppresses bone growth
  • C-type natriuretic peptide naturally counteracts FGFR3 through NPR-B activation
  • Vosoritide is an engineered CNP analog with extended half-life for practical dosing
  • The peptide 'releases the brake' on growth plates without eliminating FGFR3 entirely

Research Applications

science

Achondroplasia treatment in children

Active research area with published studies

science

Endochondral ossification and bone growth

Active research area with published studies

science

FGFR3 signaling modulation

Active research area with published studies

science

Natriuretic peptide receptor biology

Active research area with published studies

science

Skeletal dysplasia therapeutics

Active research area with published studies

science

Growth plate physiology

Active research area with published studies

science

Pediatric rare disease therapy

Active research area with published studies

science

Long-term growth outcomes

Active research area with published studies

Research Findings

Vosoritide's development followed the modern paradigm of rare disease drug development, progressing through well-designed clinical trials that led to FDA approval. The clinical evidence demonstrates clear efficacy in improving growth velocity in children with achondroplasia.

Phase 3 Pivotal Trial (Study 111)

The FDA approval was based primarily on a randomized, double-blind, placebo-controlled Phase 3 trial that enrolled 121 children aged 5-18 years with achondroplasia and open growth plates. Patients were randomized 1:1 to receive daily subcutaneous vosoritide (15 μg/kg) or placebo for 52 weeks.

Outcome Vosoritide Placebo Difference
Annual Growth Velocity (cm/year) 5.71 4.14 +1.57
Percent Improvement — — ~38%
Patients Enrolled 60 61 —

The primary endpoint—change in annualized growth velocity from baseline over 52 weeks—showed a statistically significant improvement of 1.57 cm/year with vosoritide compared to placebo (p<0.0001). This represents approximately a 38% increase in growth velocity, translating to a clinically meaningful improvement in height gain over time.

Phase 2 Dose-Finding Studies

Earlier Phase 2 trials established the optimal dose of 15 μg/kg/day. Study 004 demonstrated dose-dependent increases in growth velocity across doses of 2.5 to 30 μg/kg/day. The 15 μg/kg dose was selected for Phase 3 based on the balance of efficacy and tolerability, showing robust growth velocity improvements with an acceptable safety profile.

Long-Term Extension Data

Patients completing the pivotal trial had the option to enter open-label extension studies, providing crucial long-term efficacy and safety data. Results from 4+ years of continuous treatment demonstrate:

  • Sustained Effect: Growth velocity improvements are maintained over years of treatment without evidence of declining efficacy or tachyphylaxis
  • Cumulative Benefit: Children treated for 4+ years gained 6-8+ cm more in height than would be expected based on natural history data
  • Safety Consistency: No new safety signals emerged with prolonged exposure; injection site reactions remained the most common adverse event
  • Proportionality Improvement: Upper-to-lower body segment ratio showed trends toward normalization
✓ Clinical Significance: The ~1.5 cm/year improvement may seem modest, but accumulated over 5-10 years of treatment during childhood, it represents substantial additional height that could meaningfully impact daily function, reduce need for surgical interventions, and improve quality of life.

Younger Children (Under Age 5)

A Phase 2 study has evaluated vosoritide in infants and young children aged 0-5 years—a population not yet covered by FDA approval. Early results show similar safety and efficacy profiles, with age-appropriate improvements in growth velocity. Data from this trial may support expanded approval to younger age groups, where earlier intervention could theoretically provide greater cumulative benefit.

Biomarker Evidence

Beyond clinical growth measurements, biomarker data supports vosoritide's mechanism of action. Treated patients showed increases in collagen X biomarkers (indicating enhanced growth plate activity) and changes in bone turnover markers consistent with accelerated endochondral ossification. These biochemical findings provide mechanistic validation of the peptide's effects on growth plate biology.

Dosage & Administration

Vosoritide (Voxzogo) is approved as a once-daily subcutaneous injection for children with achondroplasia. The dosing regimen is weight-based and administered by caregivers at home following proper training from healthcare providers.

Approved Dosing

Weight Range Dose (15 μg/kg) Vial Strength Volume
10-11 kg 0.16 mg 0.4 mg vial 0.4 mL
12-16 kg 0.24 mg 0.56 mg vial 0.5 mL
17-21 kg 0.28 mg 0.56 mg vial 0.5 mL
22-32 kg 0.40 mg 1.2 mg vial 0.5 mL
33-43 kg 0.56 mg 1.2 mg vial 0.7 mL
44-59 kg 0.70 mg 1.2 mg vial 0.9 mL
60-89 kg 1.10 mg 1.2 mg vial 1.4 mL
≥90 kg 1.40 mg 1.2 mg vial 1.8 mL

Preparation and Administration

1

Allow to Reach Room Temperature

Remove the vial from refrigerator and let stand for 15-30 minutes before reconstitution.

2

Reconstitute with Provided Diluent

Add the pre-filled syringe diluent to the vial. Gently swirl—do not shake—until fully dissolved.

3

Draw Appropriate Volume

Using a new syringe, draw the correct volume based on patient weight from the dosing table.

4

Inject Subcutaneously

Administer into abdomen, thigh, or upper arm. Rotate injection sites, spacing at least 1 inch apart.

Timing and Monitoring

Vosoritide should be administered at approximately the same time each day, during waking hours. This timing is important because:

  • Transient blood pressure decreases may occur 15-90 minutes post-dose
  • The patient should be awake and able to be observed for symptoms
  • Adequate hydration before and after dosing is recommended
⚠️ Blood Pressure Monitoring: Approximately 6% of patients in trials experienced symptomatic hypotension (dizziness) after injection. Ensure adequate hydration and consider monitoring blood pressure during initial doses. Patients should avoid activities requiring alertness for 60-90 minutes after injection if symptoms occur.

Treatment Duration

Treatment should continue as long as growth plates remain open. Once epiphyses fuse (typically during mid-to-late adolescence), vosoritide no longer has a substrate to act upon and should be discontinued. Regular X-rays to assess growth plate status are part of ongoing monitoring.

Storage Requirements

Store unopened vials refrigerated at 2-8°C (36-46°F). Protect from light. Do not freeze. Once reconstituted, use within 3 hours. Do not store reconstituted solution.

Safety & Side Effects

Vosoritide demonstrated an acceptable safety profile in clinical trials, with most adverse events being mild and manageable. The FDA approval included data from over 500 patient-years of exposure across clinical development.

Common Adverse Reactions

💉

Injection Site Reactions (35%)

Redness, swelling, pain, itching, or hives at injection site. Usually mild and self-resolving.

💧

Blood Pressure Decrease (30%)

Transient drops in BP 15-90 min post-dose. Most asymptomatic; 6% had symptoms like dizziness.

🤢

Gastrointestinal (~5%)

Nausea and vomiting occurred in small percentage of patients.

Detailed Safety Data from Phase 3 Trial

In the pivotal Phase 3 study comparing vosoritide to placebo over 52 weeks:

  • Injection site reactions: 35% vosoritide vs 1.7% placebo
  • Blood pressure decrease (any): 30% vosoritide vs 3.4% placebo
  • Symptomatic hypotension: 6% vosoritide vs 0% placebo
  • Vomiting: 27% vosoritide vs 10% placebo
  • Serious adverse events: Similar rates in both groups, none attributed to treatment
  • Discontinuation due to AEs: No patients discontinued for adverse events
📝 Note: Blood pressure decreases were typically transient, resolving within 90 minutes without intervention. Most were detected on routine monitoring rather than symptoms. Symptomatic events (dizziness, feeling faint) were less common at ~6% and did not lead to discontinuations.

Long-Term Safety

Extension studies following patients for 4+ years have not revealed new safety concerns. Injection site reactions tend to diminish over time as patients and caregivers become more proficient with administration technique. Immunogenicity (development of anti-vosoritide antibodies) has been detected in some patients but has not correlated with reduced efficacy or increased adverse events to date.

Special Populations

Younger Children: Phase 2 data in children under age 5 shows a similar safety profile to older children, though this population is not yet included in FDA approval.

Pregnancy/Nursing: There are no data in pregnant or lactating individuals. The approved indication is for children, and pregnancy considerations are not directly applicable to the labeled population.

Contraindications and Precautions

The prescribing information notes:

  • Treatment should be discontinued when growth plates close
  • Monitor for signs of hypotension, especially during initial doses
  • Ensure adequate hydration before and after dosing
  • Not studied in patients with significant cardiac, hepatic, or renal impairment
Medical Disclaimer: This content is for informational purposes only and does not constitute medical advice. Vosoritide (Voxzogo) is a prescription medication that should only be used under the supervision of qualified healthcare providers experienced in treating achondroplasia. Individual results vary, and treatment decisions should be made collaboratively between patients, caregivers, and medical teams.

Frequently Asked Questions

Scientific References

1

Vosoritide therapy in children with achondroplasia: a randomized, double-blind, placebo-controlled, phase 3 trial

The Lancet (2021)

open_in_new
2

C-type natriuretic peptide analogue therapy in children with achondroplasia

New England Journal of Medicine (2019)

open_in_new
3

FDA approves first drug to improve growth in children with most common form of dwarfism

FDA News Release (2021)

open_in_new
4

Long-term effects of vosoritide in children with achondroplasia: 4-year data from an ongoing phase 3 extension study

Genetics in Medicine (2023)

open_in_new
5

C-type natriuretic peptide (CNP): a regulator of bone growth and skeletal development

Bone (2012)

open_in_new
6

Mechanism of action of vosoritide: targeting FGFR3 overactivation in achondroplasia

Expert Opinion on Pharmacotherapy (2017)

open_in_new
7

Vosoritide: First Approval

Drugs (2021)

open_in_new
8

Efficacy and safety of vosoritide in children with achondroplasia aged 0 to <5 years: results from a phase 2 study

European Journal of Endocrinology (2023)

open_in_new

Quick Reference

Molecular Weight4,105 Da (39 amino acids)
Half-Life~25-30 minutes (extended vs native CNP: 2-3 min)
PurityPharmaceutical grade (Voxzogo)
FormLyophilized powder for reconstitution (solution for injection)
SupplierAscension Peptides

Sequence

Modified CNP-39: PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

Storage

Refrigerated: 2-8°C | Protect from light | Do not freeze

Related Peptides

CJC-1295
Growth Hormone Secretagogues
arrow_forward
GHK-Cu
Skin & Anti-Aging
arrow_forward
IGF-1 LR3
Growth Factors
arrow_forward
Ipamorelin
Growth Hormone Secretagogues
arrow_forward
Sermorelin
Growth Hormone Secretagogues
arrow_forward
sciencePeptideDeck
Shop|About|Contact
© 2026 PeptideDeck
Dosing Charts
MOTS-cSermorelinSelankGHK-CuSemaglutideGLOWTesamorelin5-Amino-1MQCagrilintideMK-677FOXO4-DRIZepboundMounjaroWegovyKisspeptinSS-31Thymosin Alpha-1KPVEnclomipheneGlutathione