sciencePeptideDeck
PeptidesBlogCalculatorAI Coach
search
shopping_bagShopShop Peptidesopen_in_new
Homechevron_rightPeptideschevron_rightLL-37
Immune & Antimicrobial
scheduleHalf-life: ~15-30 minutes (serum); longer in tissue compartments

LL-37

LL-37 (Cathelicidin Antimicrobial Peptide)

shopping_cart
starResearch Grade

Purchase LL-37

Check Availabilityarrow_forward
LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans, representing a critical component of the innate immune system. This 37-amino acid peptide, beginning with two leucine residues (hence 'LL'), is cleaved from its precursor protein hCAP18 and plays essential roles in first-line defense against pathogens, wound healing, and immune regulation. Unlike conventional antibiotics, LL-37 kills bacteria through membrane disruption while simultaneously modulating inflammatory responses and promoting tissue repair. Research has expanded dramatically as antibiotic resistance has become a global health crisis, positioning LL-37 and its derivatives as promising candidates for next-generation antimicrobial therapies.
verifiedRecommended Supplier

Purchase Research-Grade LL-37

Sourced from Ascension Peptides. Verified ≥≥95% purity, third-party tested.Note: For laboratory research use only.

shopping_cartBuy Now

Table of Contents

  • What is LL-37?
  • Research Benefits
  • How LL-37 Works
  • Research Applications
  • Research Findings
  • Dosage & Administration
  • Safety & Side Effects
  • References

What is LL-37?

LL-37 is the sole cathelicidin-derived antimicrobial peptide produced by humans, representing a cornerstone of our innate immune defense. The name derives from its structure: 37 amino acids beginning with two leucine (L) residues. This peptide is cleaved from its precursor protein, human cationic antimicrobial protein 18 (hCAP18), by proteinase 3 in neutrophils or by other proteases in epithelial tissues.

37Amino Acids
4.5 kDaMolecular Weight
15-30 minSerum Half-life
+6Net Charge

Unlike conventional antibiotics that target specific molecular pathways, LL-37 kills pathogens through direct physical disruption of their membranes while simultaneously orchestrating broader immune responses. This dual functionality—combining antimicrobial killing with immunomodulation—makes LL-37 fundamentally different from any pharmaceutical antibiotic.

The peptide is expressed throughout the body wherever infection risk exists: skin and epithelial surfaces, the respiratory tract, gastrointestinal mucosa, and the urogenital system. Neutrophils, the first-responder immune cells, carry substantial LL-37 stores in their specific granules, releasing it at sites of infection. When skin is wounded or tissues become infected, local LL-37 production increases dramatically.

ℹ️ Vitamin D Connection: LL-37 expression is directly regulated by vitamin D. The vitamin D receptor binds to response elements in the LL-37 gene promoter, increasing production. This relationship explains part of vitamin D's immune-supporting reputation.

Interest in LL-37 has surged as antibiotic resistance has become a global health crisis. The World Health Organization lists antimicrobial resistance among the top ten threats to global health, and LL-37 represents a fundamentally different approach to infection control—one that bacteria find much harder to evade.

Research Benefits

check_circle

Broad-spectrum antimicrobial activity against bacteria, fungi, and viruses

check_circle

Wound healing acceleration through keratinocyte migration

check_circle

Biofilm disruption and prevention

check_circle

Immunomodulatory effects balancing inflammation

check_circle

Angiogenesis promotion for tissue repair

check_circle

Neutralization of bacterial endotoxins (LPS)

check_circle

Synergistic effects with conventional antibiotics

check_circle

Skin barrier function enhancement

How LL-37 Works

LL-37's mechanisms of action span direct antimicrobial killing, immune modulation, and tissue repair—a versatility that reflects its central role in host defense.

Membrane Disruption: The Primary Kill Mechanism

LL-37 adopts an amphipathic alpha-helical structure in membrane environments, with hydrophobic residues on one face and positively charged residues on the other. This structure allows the peptide to selectively target bacterial membranes, which have higher negative surface charge than human cell membranes.

⚡

Electrostatic Attraction

Positive charges on LL-37 are drawn to negatively charged bacterial membranes.

🔓

Membrane Insertion

The amphipathic helix inserts into the lipid bilayer, disrupting membrane integrity.

💥

Pore Formation

Multiple peptides aggregate to form pores, causing rapid bacterial death.

🛡️

Selectivity

Human cells are largely spared due to different membrane composition and cholesterol content.

The speed of this mechanism is remarkable—bacterial killing can occur within minutes of exposure. This rapid action, combined with the physical nature of membrane disruption, makes resistance development extremely difficult.

Endotoxin Neutralization

When gram-negative bacteria die, they release lipopolysaccharide (LPS), also known as endotoxin, which can trigger severe inflammatory responses including septic shock. LL-37 binds directly to LPS, neutralizing its inflammatory potential. This dual action—killing bacteria while neutralizing their toxins—provides comprehensive protection against gram-negative infections.

Biofilm Disruption

Biofilms are structured bacterial communities encased in a protective matrix, making them up to 1,000 times more resistant to antibiotics than free-floating bacteria. LL-37 disrupts biofilm formation and can penetrate established biofilms, making it valuable against chronic infections where biofilms are prevalent—from wound infections to implant-associated infections to chronic sinusitis.

Immunomodulatory Functions

Beyond direct killing, LL-37 shapes immune responses through multiple mechanisms:

  • Chemotaxis: Attracts immune cells (neutrophils, monocytes, T cells) to infection sites
  • Cytokine modulation: Influences production of inflammatory and anti-inflammatory cytokines
  • Dendritic cell activation: Bridges innate and adaptive immunity by activating antigen-presenting cells
  • Macrophage polarization: Promotes pro-resolving macrophage phenotypes to facilitate healing

Wound Healing Promotion

LL-37 actively promotes tissue repair through several mechanisms:

🔑 Wound Healing Effects

  • Stimulates keratinocyte migration for faster wound closure
  • Promotes angiogenesis through VEGF-independent pathways
  • Supports re-epithelialization of damaged tissue
  • Modulates inflammation to prevent chronic wound states

Research Applications

science

Antibiotic-resistant bacterial infections

Active research area with published studies

science

Chronic wound healing

Active research area with published studies

science

Skin disorders (psoriasis, rosacea, atopic dermatitis)

Active research area with published studies

science

Biofilm-associated infections

Active research area with published studies

science

Sepsis and endotoxemia

Active research area with published studies

science

Respiratory infections

Active research area with published studies

science

Periodontal disease

Active research area with published studies

science

Cancer immunotherapy adjuncts

Active research area with published studies

Research Findings

LL-37 research spans three decades, with particular acceleration in recent years as the antibiotic resistance crisis has intensified. The following summarizes key findings across major research areas:

Antimicrobial Efficacy

Laboratory studies demonstrate LL-37's broad-spectrum activity against gram-positive bacteria (including MRSA and VRE), gram-negative bacteria (including Pseudomonas aeruginosa and E. coli), fungi (Candida species), and enveloped viruses (including influenza and herpes simplex). Minimum inhibitory concentrations (MICs) typically range from 1-64 μg/mL depending on the pathogen and test conditions.

✓ Key Finding: A 2017 study in Frontiers in Immunology demonstrated LL-37's effectiveness against polymicrobial wound infections, showing activity against clinical isolates that were resistant to multiple conventional antibiotics.

Biofilm Research

Research published in Clinical Infectious Diseases (2008) demonstrated LL-37's ability to prevent Pseudomonas aeruginosa biofilm formation at sub-MIC concentrations and to promote the dispersal of pre-formed biofilms. This is particularly significant given that biofilm-associated infections account for approximately 80% of all chronic bacterial infections.

Wound Healing Studies

Animal studies have consistently shown accelerated wound healing with LL-37 application. A key study in the British Journal of Dermatology demonstrated that LL-37-deficient mice showed impaired wound healing, while topical LL-37 application accelerated healing in wild-type animals. The peptide increased wound re-epithelialization rates and improved tissue organization.

Research AreaKey FindingsClinical Relevance
Antimicrobial ActivityBroad-spectrum efficacy including drug-resistant strainsAlternative to failing antibiotics
Biofilm DisruptionPrevents formation and promotes dispersalChronic infection treatment
Wound HealingAccelerates closure via keratinocyte migrationChronic wound therapy
Synergy StudiesEnhanced activity with conventional antibioticsCombination therapy potential
Cancer ResearchDirect cytotoxicity to some tumor cellsImmunotherapy adjunct (investigational)

Synergy with Antibiotics

Multiple studies have demonstrated synergistic effects when LL-37 is combined with conventional antibiotics. Research shows enhanced killing of MRSA when LL-37 is combined with oxacillin, and improved efficacy against gram-negative bacteria when combined with various antibiotic classes. These combinations often achieve the same killing at lower antibiotic concentrations, potentially reducing resistance selection pressure.

Clinical Trials

LL-37 and its derivatives have entered clinical trials for several indications:

  • Chronic leg ulcers: Phase I/II trials of topical LL-37 showed promising safety and preliminary efficacy signals
  • Melanoma: Intratumoral LL-37 injection combined with CpG oligonucleotides has been investigated as an immunotherapy approach
  • OP-145 (LL-37 derivative): Evaluated for chronic middle ear infections with favorable safety profile
📝 Note: While clinical trial results are encouraging, LL-37 is not yet approved for therapeutic use. Research is ongoing to optimize delivery methods and establish optimal dosing for various indications.

Vitamin D Relationship

A substantial body of research published in Future Microbiology and other journals has established the vitamin D-LL-37 axis. Studies show that vitamin D supplementation increases LL-37 expression in respiratory epithelial cells, monocytes, and keratinocytes. This relationship has implications for understanding infection susceptibility in vitamin D-deficient populations and suggests that ensuring adequate vitamin D status may be a practical way to support endogenous LL-37 production.

Dosage & Administration

As LL-37 remains investigational for therapeutic applications, established clinical dosing protocols do not exist. The following summarizes approaches used in research settings—not recommendations for human use.

Research Concentrations

In vitro antimicrobial studies typically use LL-37 at concentrations of 1-100 μg/mL. Effective antimicrobial concentrations vary by pathogen:

ApplicationTypical ConcentrationContext
In vitro antimicrobial1-64 μg/mLMIC determination
Biofilm prevention0.5-4 μg/mLSub-MIC effects
Cell culture wound assays1-10 μg/mLMigration stimulation
Animal wound models50-200 μg/woundTopical application

Administration Routes Under Investigation

Topical: The most studied route for wound healing applications. LL-37 can be formulated in gels, creams, or wound dressings. Topical delivery localizes the peptide where needed while minimizing systemic exposure.

Injection: Local injection has been explored for deep tissue infections and in cancer immunotherapy studies. Intratumoral injection of LL-37 combined with immune adjuvants has been evaluated in melanoma trials.

Inhalation: Being investigated for respiratory infections, particularly for conditions like cystic fibrosis where chronic Pseudomonas infection is common.

⚠️ Important Consideration: LL-37 has a short serum half-life (15-30 minutes) due to protease degradation. This limits systemic applications and has driven research into peptide modifications and alternative delivery systems to extend activity.

Stability and Handling

LL-37 is supplied as a lyophilized powder for research use. Standard handling practices:

1

Storage

Store lyophilized peptide at -20°C to -80°C. Protect from moisture.

2

Reconstitution

Dissolve in sterile water or appropriate buffer. LL-37 is soluble in aqueous solutions at research concentrations.

3

Solution Storage

Store reconstituted solution at 2-8°C for short-term use (up to 7 days). Aliquot and freeze for longer storage.

4

Avoid

Repeated freeze-thaw cycles, exposure to proteases, and extended room temperature storage.

Modified Peptides

Researchers have developed LL-37 derivatives to overcome the native peptide's limitations. Modifications include:

  • Truncated versions: Shorter peptides retaining antimicrobial activity (e.g., LL-23, LL-17)
  • D-amino acid substitutions: Increased protease resistance
  • Lipidation: Improved membrane interaction and activity
  • Cyclization: Enhanced stability and sometimes improved activity

Safety & Side Effects

LL-37's status as an endogenous human peptide provides inherent biocompatibility advantages. However, therapeutic applications require careful consideration of dose-dependent effects and context-specific responses.

Preclinical Safety Data

Topical LL-37 application in animal wound healing studies has generally shown good local tolerability. Systemic exposure at research doses has not revealed major toxicity in animal models. The peptide's short half-life limits systemic accumulation.

⚠️ Dose-Dependent Effects: At high concentrations (typically >100 μg/mL), LL-37 can affect human cells, causing cytotoxicity to keratinocytes, fibroblasts, and immune cells. This cytotoxicity likely relates to the same membrane-active properties that kill bacteria. Therapeutic applications must balance efficacy against potential cellular toxicity.

Immunological Considerations

LL-37's immunomodulatory properties are context-dependent:

  • Pro-inflammatory potential: In some settings, LL-37 can enhance inflammatory responses. In diseases like psoriasis and rosacea, elevated LL-37 contributes to pathological inflammation.
  • Anti-inflammatory effects: In other contexts, LL-37 dampens inflammation by neutralizing LPS and modulating cytokine production.
  • Autoimmune considerations: LL-37 has been implicated in forming complexes with self-DNA that can trigger type I interferon responses, potentially relevant to conditions like lupus.

Clinical Trial Safety

Phase I/II clinical trials of topical LL-37 for chronic leg ulcers reported:

  • Good local tolerability
  • No serious adverse events attributed to treatment
  • Mild, transient local reactions in some patients (redness, warmth) consistent with expected immunomodulatory activity

🔑 Safety Summary

  • Endogenous origin provides inherent biocompatibility
  • Cytotoxicity risk at high concentrations requires careful dose selection
  • Immunomodulatory effects can be pro- or anti-inflammatory depending on context
  • Clinical trials to date show acceptable safety profiles at studied doses
  • Long-term safety data in humans remains limited

Selectivity for Bacterial Membranes

LL-37's selectivity for bacterial over human membranes provides a therapeutic window, but this selectivity is not absolute. Factors contributing to preferential bacterial killing include:

  • Higher negative charge on bacterial membranes (phosphatidylglycerol, cardiolipin) vs. zwitterionic phospholipids in human membranes
  • Cholesterol content in human membranes reduces LL-37 insertion
  • Differences in membrane fluidity and lipid composition

However, at sufficiently high concentrations, these differences become less protective, and human cell damage can occur.

Frequently Asked Questions

Scientific References

1

LL-37, the only human member of the cathelicidin family of antimicrobial peptides

Biochimica et Biophysica Acta (2003)

open_in_new
2

The human cathelicidin antimicrobial peptide LL-37 as a potential treatment for polymicrobial infected wounds

Frontiers in Immunology (2017)

open_in_new
3

Cathelicidin antimicrobial peptides modulate skin wound healing and immunodefense

British Journal of Dermatology (2008)

open_in_new
4

Vitamin D and the human antimicrobial peptide LL-37

Future Microbiology (2014)

open_in_new
5

Antimicrobial peptide LL-37 promotes bacterial phagocytosis by human macrophages

Journal of Leukocyte Biology (2008)

open_in_new
6

The antimicrobial peptide LL-37 inhibits biofilm formation of Pseudomonas aeruginosa

Clinical Infectious Diseases (2008)

open_in_new
7

LL-37: An immunomodulatory antimicrobial host defence peptide

Immunology (2016)

open_in_new
8

Human cathelicidin LL-37 enhances angiogenesis

The FASEB Journal (2003)

open_in_new

Quick Reference

Molecular Weight4,493.33 Da
Half-Life~15-30 minutes (serum); longer in tissue compartments
Purity≥95%
FormLyophilized powder (white)
SupplierAscension Peptides

Sequence

[LL-37, 37 aa]

Storage

Lyophilized: -20°C to -80°C | Reconstituted: 2-8°C, use within 7 days

Related Peptides

BPC-157
Healing & Recovery
arrow_forward
TB-500
Healing & Recovery
arrow_forward
KPV
Anti-Inflammatory & Gut Health
arrow_forward
Thymosin Alpha 1
Healing & Recovery
arrow_forward
GHK-Cu
Skin & Anti-Aging
arrow_forward
sciencePeptideDeck
About|Contact© 2026 PeptideDeck. Research Purposes Only. Not for human consumption.