sciencePeptideDeck
shopping_bagShop Peptidesopen_in_newOral PeptidesnewBlogPeptide CalculatorAI Coach
OralnewShop
menu_bookPeptide Guide
Homechevron_rightPeptideschevron_rightKisspeptin
Sexual Health & Reproductive
scheduleHalf-life: ~4 minutes (IV) | ~27 minutes (SC)

Kisspeptin

Kisspeptin (Metastin, KISS1 Gene Product)

shopping_cart
starRecommended

Purchase Kisspeptin

Buy Nowarrow_forward
Kisspeptin is a family of neuropeptides encoded by the KISS1 gene that plays a fundamental role in regulating the hypothalamic-pituitary-gonadal (HPG) axis. Acting through the kisspeptin receptor (KISS1R/GPR54), this peptide is essential for puberty onset, gonadotropin secretion, and reproductive function. Research has demonstrated kisspeptin's ability to stimulate the pulsatile release of gonadotropin-releasing hormone (GnRH), making it critical for fertility in both males and females. The discovery of kisspeptin's role in reproduction has opened new avenues for treating infertility, hypogonadism, and understanding conditions like polycystic ovary syndrome (PCOS). Clinical trials have explored kisspeptin administration for triggering ovulation in IVF protocols and restoring testosterone in hypogonadal men.
verifiedRecommended Supplier

Get Kisspeptin

Sourced from Ascension Peptides. Verified ≥≥98% purity, third-party tested. COA included.

shopping_cartBuy Now
50%

Off with code

PEPTIDEDECK

Table of Contents

  • What is Kisspeptin?
  • Research Benefits
  • How Kisspeptin Works
  • Research Applications
  • Research Findings
  • Dosage & Administration
  • Safety & Side Effects
  • References

What is Kisspeptin?

Kisspeptin is a neuropeptide encoded by the KISS1 gene that serves as the master regulator of reproductive function in mammals, including humans. First discovered in 1996 as a tumor metastasis suppressor (hence its original name "metastin"), its crucial role in reproduction was only recognized in 2003 when researchers found that mutations in the kisspeptin receptor (GPR54/KISS1R) caused a complete failure of puberty and fertility.

54 AA Full-Length (KP-54)
~4 min IV Half-Life
~27 min SC Half-Life

This discovery revolutionized reproductive neuroendocrinology. Kisspeptin acts at the apex of the hypothalamic-pituitary-gonadal (HPG) axis, stimulating specialized neurons in the hypothalamus to release gonadotropin-releasing hormone (GnRH). GnRH then triggers the pituitary to secrete luteinizing hormone (LH) and follicle-stimulating hormone (FSH), which control testosterone production in males and ovulation in females.

The KISS1 gene produces a 145-amino acid precursor protein that's processed into several bioactive fragments. Kisspeptin-54 (KP-54) is the full-length active peptide, but shorter fragments—KP-14, KP-13, and KP-10—all retain biological activity. These fragments share a critical C-terminal RF-amide motif that binds the KISS1R receptor. In research and clinical trials, both KP-54 and KP-10 are commonly used, depending on the specific application.

ℹ️ Discovery Story: Kisspeptin was named after Hershey's Kisses chocolates because the gene was discovered in Hershey, Pennsylvania. Its original "metastin" name reflected early cancer research, but the "kiss" nickname stuck as reproductive functions became the primary research focus.

Kisspeptin neurons are concentrated in specific hypothalamic regions: the arcuate nucleus (ARC) and the anteroventral periventricular nucleus (AVPV) in rodents, or the infundibular nucleus in humans. These neurons integrate signals from sex steroids, metabolic status, stress hormones, and circadian rhythms to coordinate reproductive function. This integration explains why factors like body weight, stress, and sleep affect fertility—they all influence kisspeptin signaling.

Research Benefits

check_circle

Master regulator of GnRH pulsatile release

check_circle

Triggers LH and FSH secretion for reproductive function

check_circle

Stimulates natural testosterone production in males

check_circle

Promotes ovulation and follicular development in females

check_circle

Potential IVF trigger with reduced OHSS risk

check_circle

May restore hypothalamic function in functional hypothalamic amenorrhea

check_circle

Research applications in puberty and pubertal disorders

check_circle

Possible role in metabolic regulation and energy balance

How Kisspeptin Works

Kisspeptin's mechanism centers on its role as the gatekeeper of GnRH release. The peptide binds to KISS1R (GPR54), a G-protein coupled receptor expressed on GnRH neurons in the hypothalamus. This binding triggers a cascade that stimulates GnRH secretion, ultimately controlling the entire reproductive hormone axis.

🔑

GnRH Gate Control

Directly stimulates GnRH neurons to release gonadotropin-releasing hormone in pulsatile patterns.

📈

LH/FSH Surge

Triggers pituitary release of luteinizing hormone and follicle-stimulating hormone.

⚖️

Steroid Feedback

Mediates sex steroid feedback—estrogen and testosterone regulate kisspeptin neurons.

🔄

Pulse Generation

Works with neurokinin B and dynorphin (KNDy neurons) to generate GnRH pulses.

The KISS1R Signaling Cascade

When kisspeptin binds KISS1R, it activates Gq/11 proteins, leading to phospholipase C activation and increased intracellular calcium. This calcium surge in GnRH neurons triggers GnRH secretion. The signaling also activates MAP kinase pathways, which may contribute to longer-term effects on GnRH neuron function and gene expression.

KNDy Neurons: The Pulse Generator

Kisspeptin neurons in the arcuate nucleus co-express two other neuropeptides: neurokinin B (NKB) and dynorphin. These "KNDy neurons" function as the GnRH pulse generator. Neurokinin B stimulates kisspeptin release, which triggers GnRH secretion, while dynorphin inhibits the process, creating the pulsatile pattern essential for reproductive function. Disruption of this pulse generator underlies various reproductive disorders.

Sex Steroid Feedback

Kisspeptin neurons express estrogen and androgen receptors, making them the primary target for sex steroid feedback on the reproductive axis. In females, low estrogen levels suppress kisspeptin and GnRH, while the preovulatory estrogen surge paradoxically stimulates kisspeptin neurons (the "positive feedback" that triggers ovulation). In males, testosterone provides negative feedback through kisspeptin neurons to maintain stable hormone levels. This feedback mechanism explains why kisspeptin dysfunction causes both hypogonadism and precocious puberty.

📝 Key Point: Unlike direct GnRH administration (which can desensitize receptors with continuous exposure), kisspeptin triggers physiological, self-limiting GnRH pulses. This property makes it attractive for therapeutic applications where maintaining receptor sensitivity is important.

Research Applications

science

Female infertility and IVF protocols

Active research area with published studies

science

Male hypogonadism and testosterone deficiency

Active research area with published studies

science

Functional hypothalamic amenorrhea

Active research area with published studies

science

Polycystic ovary syndrome (PCOS)

Active research area with published studies

science

Puberty disorders and precocious puberty

Active research area with published studies

science

Metabolic syndrome and obesity

Active research area with published studies

science

Reproductive neuroendocrinology

Active research area with published studies

science

GnRH neuron physiology

Active research area with published studies

Research Findings

Research on kisspeptin has expanded dramatically since its reproductive role was discovered in 2003. Clinical trials have explored applications from infertility treatment to understanding puberty disorders, with particularly promising results in IVF protocols.

IVF and Oocyte Maturation Trigger

One of the most clinically advanced applications is using kisspeptin to trigger final oocyte maturation in IVF. Traditional triggers (hCG or GnRH agonists) can cause ovarian hyperstimulation syndrome (OHSS), especially in high-responding patients. Research from Imperial College London demonstrated that kisspeptin-54 (1.6-12.8 nmol/kg) successfully triggered oocyte maturation while producing significantly lower estradiol peaks than standard protocols.

A 2022 meta-analysis in Human Reproduction Update found kisspeptin triggers showed promise for OHSS risk reduction while maintaining acceptable pregnancy rates. The physiological, self-limiting LH surge produced by kisspeptin—rather than the prolonged stimulation from hCG—appears to underlie this safety advantage.

🔑 Key Findings: IVF Research

  • Kisspeptin-54 successfully triggers oocyte maturation in human IVF
  • Lower peak estradiol and reduced OHSS markers compared to standard triggers
  • Self-limiting LH surge mimics natural physiology
  • Pregnancy rates appear comparable in controlled studies

Male Hypogonadism and Testosterone

Studies in men with various forms of hypogonadism have demonstrated that kisspeptin can stimulate testosterone production. Intravenous kisspeptin infusion produces robust LH pulses and subsequent testosterone elevation in hypogonadal men. Research published in the Journal of Clinical Endocrinology & Metabolism showed kisspeptin can restore pulsatile LH secretion even in patients with neurokinin B signaling deficiencies.

The challenge for therapeutic development is kisspeptin's very short half-life. Continuous infusion is effective but impractical. Current research explores longer-acting analogs and optimal intermittent dosing strategies.

Functional Hypothalamic Amenorrhea

Women with functional hypothalamic amenorrhea (FHA)—where stress, low body weight, or excessive exercise suppresses menstruation—have shown restored LH pulsatility with kisspeptin administration. This suggests kisspeptin could bypass the suppressed hypothalamic function in these patients. Studies show that even brief kisspeptin exposure can reinitiate the pulsatile hormone patterns absent in FHA.

Research Context Kisspeptin Form Dose Range Route
IVF Trigger KP-54 1.6-12.8 nmol/kg SC
LH Stimulation KP-10 or KP-54 0.1-1.0 μg/kg IV Bolus
Pulsatile Infusion KP-10 0.1-0.3 μg/kg/pulse IV Infusion

Puberty and Development

Kisspeptin signaling is essential for puberty onset. Activating mutations in KISS1R cause precocious puberty, while inactivating mutations prevent puberty entirely. This has led to research on kisspeptin system manipulation for pubertal disorders. In animal models, kisspeptin administration to prepubertal subjects advances pubertal timing, while kisspeptin antagonists can delay it.

Metabolic Integration

Kisspeptin neurons respond to metabolic signals including leptin, insulin, and ghrelin. This integration explains the link between nutritional status and fertility. Research shows that metabolic disorders like obesity and diabetes alter kisspeptin expression. Conversely, kisspeptin may influence glucose metabolism—studies suggest effects on insulin secretion and glucose homeostasis, opening potential metabolic applications beyond reproduction.

Dosage & Administration

Kisspeptin dosing in research settings varies significantly based on the specific application, the form of kisspeptin used, and the route of administration. Human clinical trials have established some dosing parameters, though standardized therapeutic protocols do not yet exist as kisspeptin remains investigational.

⚠️ Research Compound: Kisspeptin is not approved for therapeutic use. All dosing information comes from clinical research studies and should not be interpreted as treatment recommendations.

Forms and Equivalence

Multiple kisspeptin fragments are used in research:

  • Kisspeptin-54 (KP-54): Full-length active peptide; MW ~5,847 Da
  • Kisspeptin-10 (KP-10): Minimal active fragment; MW ~1,302 Da; equimolar receptor activity
  • Kisspeptin-13/14: Intermediate fragments with full receptor activity

Since all fragments share the receptor-binding C-terminus, they have similar potency at KISS1R. Dosing is typically expressed in molar terms (nmol/kg) rather than mass to account for molecular weight differences.

Research Protocols by Application

IVF Oocyte Trigger Studies

Clinical trials at Imperial College London used subcutaneous kisspeptin-54 at doses ranging from 1.6 to 12.8 nmol/kg as a trigger for final oocyte maturation. Higher doses (9.6-12.8 nmol/kg) produced more consistent responses. Administration timing followed standard IVF trigger protocols (typically 36 hours before oocyte retrieval).

Gonadotropin Stimulation Studies

Studies examining acute LH/FSH responses typically use intravenous bolus administration of kisspeptin-10 at 0.1-1.0 μg/kg. This produces a rapid but short-lived gonadotropin surge, peaking within 30-60 minutes.

Pulsatile Infusion Protocols

To overcome the short half-life, some research protocols use pulsatile IV infusion, administering kisspeptin every 60-90 minutes to mimic natural GnRH pulsatility. Doses of 0.1-0.3 μg/kg/pulse have restored LH pulsatility in patients with functional hypothalamic amenorrhea.

Half-Life Considerations

Kisspeptin's extremely short half-life presents significant challenges:

  • Intravenous half-life: approximately 4 minutes
  • Subcutaneous half-life: approximately 27 minutes

This rapid clearance means sustained effects require either repeated dosing or continuous infusion. Research is ongoing into longer-acting kisspeptin analogs that maintain receptor activity while extending duration of action.

Reconstitution and Handling

Kisspeptin peptides are supplied lyophilized and require reconstitution before use:

  • Reconstitute with bacteriostatic water or sterile saline
  • Store reconstituted solution at 2-8°C
  • Use within 7-14 days of reconstitution
  • Lyophilized powder stable at -20°C for extended periods
  • Avoid repeated freeze-thaw cycles

Safety & Side Effects

Kisspeptin has demonstrated a favorable safety profile in clinical research, which is perhaps expected given its role as a natural regulatory peptide in the body. Most adverse effects reported in trials are mild and transient.

✓ Good to Know: As an endogenous neuropeptide, kisspeptin activates the same pathways as the body's natural kisspeptin. This may contribute to its favorable tolerability profile compared to synthetic pharmaceutical agents.

Reported Side Effects in Clinical Trials

  • Facial flushing: The most commonly reported effect, typically mild and transient
  • Injection site reactions: Minor local effects with subcutaneous administration
  • Nausea: Occasionally reported, generally mild
  • Abdominal discomfort: Rare, typically resolves quickly
  • Headache: Infrequently reported

Safety Advantages in IVF

Kisspeptin's most notable safety feature in IVF research is the reduced risk of ovarian hyperstimulation syndrome (OHSS) compared to traditional triggers. OHSS can be a serious, potentially life-threatening complication of IVF. Kisspeptin produces a physiological, self-limiting LH surge rather than the prolonged stimulation from hCG, resulting in:

  • Lower peak estradiol levels
  • Reduced ovarian enlargement
  • Decreased OHSS markers
  • Shorter duration of ovarian stimulation

No Receptor Desensitization (Short-Term)

Unlike continuous GnRH agonist administration, which causes receptor desensitization and eventual hormone suppression, short-term kisspeptin administration maintains receptor sensitivity. The pulsatile nature of kisspeptin-induced GnRH release preserves the normal physiological response pattern.

Considerations and Unknowns

  • Long-term safety: Most studies involve short-term administration; long-term safety data is limited
  • Repeated dosing: Effects of repeated kisspeptin administration over extended periods are not fully characterized
  • Drug interactions: Potential interactions with hormonal medications or other drugs affecting the reproductive axis are not well studied
  • Contraindications: Theoretical concerns in hormone-sensitive cancers, though direct evidence is lacking
⚠️ Pregnancy Consideration: Kisspeptin is involved in normal pregnancy physiology, with placental production increasing dramatically. However, exogenous kisspeptin administration during pregnancy has not been studied for safety. IVF trigger studies administer kisspeptin before conception.

Frequently Asked Questions

Scientific References

1

Kisspeptin and the control of gonadotropin secretion in humans

Human Reproduction Update (2011)

open_in_new
2

Kisspeptin as a fertility trigger in IVF: a systematic review and meta-analysis

Human Reproduction Update (2022)

open_in_new
3

Kisspeptin-54 triggers egg maturation in women undergoing in vitro fertilization

Journal of Clinical Investigation (2014)

open_in_new
4

The kisspeptin/GPR54 system as a therapeutic target for reproductive and metabolic disorders

Nature Reviews Endocrinology (2018)

open_in_new
5

Kisspeptin administration stimulates gonadotropin release and advances puberty in juvenile male monkeys

Endocrinology (2006)

open_in_new
6

Kisspeptin restores pulsatile LH secretion in patients with neurokinin B signaling deficiencies

Journal of Clinical Endocrinology & Metabolism (2014)

open_in_new
7

Discovery of kisspeptins and their role in reproduction

Cell Metabolism (2007)

open_in_new
8

Kisspeptin signaling in the hypothalamic-pituitary-gonadal axis

Frontiers in Neuroendocrinology (2010)

open_in_new

Quick Reference

Molecular Weight5,847.7 Da (Kisspeptin-54)
Half-Life~4 minutes (IV) | ~27 minutes (SC)
Purity≥98%
FormLyophilized powder (white)
SupplierAscension Peptides

Sequence

GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 (KP-54)

Storage

Lyophilized: -20°C for long-term | Reconstituted: 2-8°C, use within 7-14 days

Related Peptides

Oxytocin
Hormonal & Social
arrow_forward
PT-141
Sexual Health
arrow_forward
Gonadorelin
Hormonal / PCT
arrow_forward
Melanotan II
Tanning & Sexual Health
arrow_forward
sciencePeptideDeck
Shop|About|Contact
© 2026 PeptideDeck
Dosing Charts
MOTS-cSermorelinSelankGHK-CuSemaglutideGLOWTesamorelin5-Amino-1MQCagrilintideMK-677FOXO4-DRIZepboundMounjaroWegovyKisspeptinSS-31Thymosin Alpha-1KPVEnclomipheneGlutathione